DPCstruct | MC47872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 150 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1J828 | 3-129 | LDSQDTIFVHFKRNKLQSKTVFPIDSFGVQKRWYTITLGNSYEKKFIRFYFQEYTSPEKRDKKTKSDVRTENKLFLKKHKKQIVGID… |
| A0A2V4Y9T4 | 8-154 | IFIIPIAVLSQNKKQDLYVAYDKCSIHNITKISNDTLQFELYQIRFGDKIKPEIEYSIAESGFVKKNISLSGKTYGFLLVTYINENK… |
| A0A7Y3R7Y0 | 158-298 | None |
| A0A316RCN0 | 5-168 | None |
| A0A2T6BQT7 | 2-158 | None |
| A0A2K8WYD7 | 33-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.