DPCstruct | MC47870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.58 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0123- CL0060- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0P7V8 | 18-117 | LDQDVKTKEEINIDLIISKVSKFFGISKKEIKSKSRKLSVSWARHICVYLDKKLLNKSLNEIGRDFNMDHSSVIYIIRKVNEKMKNL… |
| A0A5C7PH27 | 5-97 | PETLIDAAIAAASKTWGVSPQVITSRNRTEAVLKPRFAIYHFAVCHLGLAANQAGKILNLDHGTILNGIRKLDAWRSTSKVVRQQVE… |
| A0A7C2TRZ7 | 136-229 | None |
| A0A844YLL3 | 103-214 | None |
| A0A3C0F9A5 | 1-115 | None |
| A0A7C7RXV7 | 7-110 | None |
| A0A7C6W806 | 54-149 | None |
| A0A1M3IDF7 | 12-106 | None |
| A0A318T8I2 | 426-529 | None |
| A0A6J5JVE2 | 251-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.