DPCstruct | MC4787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 229 ± 26 aa |
| Standard deviation of domain lengths | 25.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 15.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523Q7L0 | 97-327 | GVAVERELQQARLMRSEFSEMLDVAQKSLAASGPIDTSALARPSKAKGDLATWEMLVKGMAKRGLDLRQEYEAELTRVGLGRLLDGR… |
| A0A829YEF8 | 3-190 | PAEAELVNVARRFAAVGAQVAQTFEQGQRQLRLDLLLSQERLCTAEGAQTSLAALEQLRHLVAAHKQAFSKFVTESSAQFAAVLAQL… |
| A0A366HQ41 | 63-348 | None |
| A0A3E1SD65 | 163-391 | None |
| A0A7Y5SAI0 | 87-296 | None |
| A0A0S2DNW3 | 56-284 | None |
| A0A7C5ZGB6 | 216-436 | None |
| A0A7X8PZS1 | 156-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.