DPCstruct | MC47865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 125 ± 18 aa |
| Standard deviation of domain lengths | 17.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14770 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1E6F1 | 3-115 | FYHAVDWTESWIRCVLAMEVLTLIAAVALRKSETAQTVLFVWCMLVAFSARTLNEWGGRHWRSFSKQNYFDENGFFISTVLSTPMMV… |
| A0A452Z6V9 | 1-84 | CLMAFHAGLLLTAVGLRRNANLQFFFLFLAYSGVYLAEKINIYLAEHWKIFASRNYFDRAGVFISVVWSGPLVFISIVTVVLAL |
| A0A7S2R2W0 | 51-188 | None |
| A0A7S3C4B7 | 175-313 | None |
| A0A3L6VMB7 | 131-254 | None |
| A0A194PKM3 | 14-132 | None |
| A0A2P8Y1M6 | 9-120 | None |
| A0A7S2UMC0 | 90-218 | None |
| T1EIG4 | 1-89 | None |
| A0A7S2Y0G5 | 54-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.