DPCstruct | MC47863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 158 ± 20 aa |
| Standard deviation of domain lengths | 19.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 23.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1E1R9 | 86-220 | AAVYYMEDTVENKRKECEAFPVDEEVEAREKKVQAKKHAYKAVTSWNALPKLDKCLLGASLFLMTLACHIAGNFGSLCFATFSVTCS… |
| A0A7S2QM85 | 29-204 | GILWVIAAWAIQNQLENNYKELTKPLPENVDLEWLDFKANEIKRSLKITWPNIPRSIQLLYAGCCLVQILMCQGMYWGHAYLFNPFE… |
| A0A7S4QS45 | 2-132 | None |
| A0A7S0DVH0 | 245-405 | None |
| A0A830HJM2 | 4-143 | None |
| A0A6T9L466 | 104-254 | None |
| A0A7S3SZN9 | 45-209 | None |
| A0A7S0C0J6 | 37-178 | None |
| A0A0M0KAM5 | 337-525 | None |
| A0A7S2CQ52 | 2-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.