DPCstruct | MC47853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 154 ± 13 aa |
| Standard deviation of domain lengths | 13.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812WHB8 | 10-153 | TFEDLTPFEVEHFVQDLQEFKLESVGDPRWLTQHERVEKLNWTAHNQAKEGLDEFVVDQFNTQEKVPALIYDLMLIEVWKERIWPLI… |
| A0A6P3YA32 | 1-166 | MTDHTENIISPWEIEAFVQNLDISVLENVGTKSWLEFHKRLTLLNQQSVLEVTGLREESVIEWFTSLKKIPVLIHEVIQIDIWKHKV… |
| A0A2P6NFZ4 | 12-169 | None |
| X6P6U0 | 1-169 | None |
| D2W1M9 | 3-154 | None |
| F4P107 | 1-147 | None |
| A0A5A8DDD4 | 10-132 | None |
| A0A0M0KAD8 | 20-191 | None |
| A0A3F2RXV6 | 7-155 | None |
| A0A1D2MM09 | 12-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.