DPCstruct | MC4785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 153 ± 14 aa |
| Standard deviation of domain lengths | 13.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0KSB6 | 2-129 | MQRYLPDAWLFAILLTLVVFIMGLIFTPAGPLDMITYWGDGFFNLLAFSMQMTLVLVTGHVMASTKPVKAVLQALARSAGTAGRAIV… |
| A0A3T1E1J8 | 3-165 | ALANFFTRLVNRYMPDPLVIAIFLTILTMMLAVLIQGTSPLNAVRYWGDGFWNLLAFSMQMTVILLAGYILAKTPLIDGALNQIATR… |
| A0A543BUH9 | 1-159 | None |
| K1L4K4 | 10-155 | None |
| A0A0M3SWW4 | 2-170 | None |
| X8F8W7 | 17-170 | None |
| D4YNE9 | 2-139 | None |
| A0A358H395 | 7-177 | None |
| A0A438AEN3 | 2-134 | None |
| A0A3T1DXC2 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.