DPCstruct | MC47848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 23 aa |
| Standard deviation of domain lengths | 22.67 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 93.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5X2M6 | 244-335 | GNVSVESYVELHDPDHKVKFALVNEFTTDRVLTGADFDVESMRVAPDGTIWIGDELGPFLLHFDSAGKLLDEPLALPDPENPAREVR… |
| A0A0Q9J445 | 139-225 | GEIEIERFITYNDADRVLDFPIVNEATPDRLLTGADFDIESVVLAKDGTFWVGEEFGPFLLHFDSDGTLLEKPYPLPGGAKSPQNPY |
| A7BMN1 | 26-151 | None |
| H8GTD2 | 88-166 | None |
| A0A6V8KY11 | 1-115 | None |
| A0A7J6ZF80 | 205-331 | None |
| A0A6L9YC84 | 97-174 | None |
| A0A2N4T0A9 | 17-134 | None |
| Q8Z028 | 96-163 | None |
| A0A1W9JC16 | 45-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.