DPCstruct | MC4784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4JCK1 | 102-201 | RRRLLADAANIDQLVEWGCVEPLIDSEIADPETGAVLAVAEAFWPDGLQPGQGAPVVLELDEDAANLARLEELGFEVYTSVSALRGR… |
| A0A3E0KRY4 | 1-118 | MSAVDVGIPAAMLGGVAGEEEERMLIDLNVWVVEQGLPEGEFLYELVGAGSSEPLAILDLAWPEGLQPGFSEPVAVLLDEDHHVHEV… |
| A0A1V5KC79 | 160-278 | None |
| A0A6B0YF69 | 1-106 | None |
| A0A7W4D4T3 | 170-283 | None |
| A0A7K2C1J4 | 2-79 | None |
| A0A6N4V6N9 | 537-643 | None |
| U5EM38 | 534-642 | None |
| A0A5K1IJ65 | 48-147 | None |
| A0A7Y5XC50 | 341-457 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.