DPCstruct | MC47839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 177 ± 28 aa |
| Standard deviation of domain lengths | 28.13 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377E329 | 15-223 | HEMSSGKDTPSGHWEIAGVPVLFEWGYFSDHENSFPQELLDKLVERANLPGYLGNCHSSGTVILDQLGEEHMKTGKPIFYTSADSVF… |
| B4D6X8 | 29-226 | AGKDSTTGHWEMAGAILDHPFATFTEFPADFVAAISRDAKVEFLGNYARSGTTILEELGSEHLRTGKPILYTSADSVLQIAAHEQVI… |
| A0A376K6M5 | 17-146 | None |
| A0A7E4RZW9 | 736-910 | None |
| A0A3D2CNY1 | 94-264 | None |
| A0A4Q3VBM5 | 172-329 | None |
| A0A3S4NEJ6 | 1-156 | None |
| A0A2X3F2U5 | 85-300 | None |
| A0A3D9KUY9 | 398-595 | None |
| A0A077ZFN7 | 1071-1247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.