DPCstruct | MC47837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 8 aa |
| Standard deviation of domain lengths | 8.46 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0373 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377E1E1 | 1-148 | MMPFSNVEAWINSELATEFAEQEEIAFTSGDGTKKPKGFLAYESTDETDKVRAFGKLQHIVSGEATAVTADAIIKLIYTLRKAHRTG… |
| A0A223I0W6 | 211-346 | SVFNLEQYIAKEFARRIGAKEEEAFFIGDGSGKPTGILADNGGGEIGVTAASATAITLDEIMDLFYSLKSPYRRNAVFIMNDSTIKA… |
| A0A1V2H8J5 | 28-169 | None |
| A0A386UM55 | 57-208 | None |
| A0A4R4A8U2 | 254-382 | None |
| A0A560FKK8 | 632-763 | None |
| A0A2R4JY38 | 67-214 | None |
| A0A7V4ZD68 | 542-674 | None |
| A0A524INM6 | 333-457 | None |
| A0A7Z8LRS0 | 106-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.