DPCstruct | MC47830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 120 ± 14 aa |
| Standard deviation of domain lengths | 14.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3TIM1 | 2-107 | SLEKMEHDFSTTVDEQLPIFQSLATAGKIDEALDKCYSLEKQTRLASDAISTGRLLVCIVDILGELKQWQKLNEHLIIMSKKRNQLK… |
| A0A1D6HQ00 | 5-109 | GTNLDAAIESLLNVEKQMRLAGDVAGTRKAVIDIVELCYKAGAWKTLNDQIVLLSKRRGQLKQAITAMVQKAMEYIDLTPGIDTSIE… |
| A0A507EKR4 | 2-125 | None |
| A0A6N2LYI4 | 309-409 | None |
| B7P9W6 | 6-115 | None |
| A0A194VYK6 | 589-711 | None |
| S4R8X2 | 16-114 | None |
| A0A6S9CDF6 | 8-164 | None |
| A0A2T7PN09 | 480-577 | None |
| A0A3P6SVG5 | 3-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.