DPCstruct | MC47829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 162 ± 31 aa |
| Standard deviation of domain lengths | 30.80 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.81 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | PF08771- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5CED2 | 139-279 | VIGHFETVNDTRTEEAAPNLVRHVAAAVQGFFRSIALRSDASFQETLRVLTLWFKFGAHEEVSMAMTDGFHTVNVTTWLEVIPQIIA… |
| A0A6J1W680 | 214-347 | VQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPEVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRP… |
| G1Q8A9 | 376-524 | None |
| E4ZI06 | 297-430 | None |
| A0A7J6RTD7 | 3-208 | None |
| K7GTI0 | 400-536 | None |
| A0A397EBC9 | 1-223 | None |
| A0A452YXW1 | 222-387 | None |
| A0A7J6GL86 | 430-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.