DPCstruct | MC47826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 44.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482XQ71 | 30-132 | ESEFWSHVATRQSHVCVHSGSIDSGAYGYGFPIVKNSATSKHPWNLKVLTNNSGTILRSLGPLMGVTVPTLHVGMVFTACCWYRDPH… |
| A0A0R3TGB5 | 1-108 | MQDYSEDVIVEYGADVHASSHGSGFPTEKLLNTMTEKLNPDERRRALEYAQSPWNLNNLPLVGNSVLRFIKGNVDGMKVPWCYVGMV… |
| A0A3N4JBM3 | 95-177 | None |
| A0A1S8WJF5 | 88-184 | None |
| A0A3B5XX74 | 79-162 | None |
| A0A183HBI1 | 8-130 | None |
| A0A507EW64 | 338-441 | None |
| A0A6J3BZZ5 | 68-164 | None |
| A0A452Y7F6 | 199-269 | None |
| A0A183WEY0 | 125-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.