DPCstruct | MC47825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 141 ± 17 aa |
| Standard deviation of domain lengths | 17.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1PID2 | 162-299 | FQTLLTEICTRIPETGFLLLYFMKVHVKLQTRKNAQQSAQFKTNIYRMICDAVDKKLDDCLARDLDLLEKENTNIYLWLLPDIYREF… |
| A0A0R3TG92 | 1-186 | MNRNDAKREILLLLLTEIQIRQPRIGYHLLYFLTVRSDSTFVLCNLFFYCSFSNNINDEKMIAYKNFCASSENSSLLECLHRDLQLL… |
| A0A7R9JNA1 | 66-182 | None |
| A0A1I8IPU1 | 491-629 | None |
| A0A6P4EMV3 | 398-535 | None |
| A0A4Z2DMH5 | 868-1003 | None |
| A0A094ZWK3 | 463-596 | None |
| A0A6M2DXT3 | 2-142 | None |
| A0A3Q0KSG9 | 920-1055 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.