DPCstruct | MC47821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 267 ± 32 aa |
| Standard deviation of domain lengths | 31.67 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.95 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0023- CL0220- PF08355 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0ALL1 | 8-217 | PSLKIPPGSSTELSHRGQQFLVALFERYDKDVDGALSPEEHRMIFSTCPSTPWSYSTDIRKSCPVNENGWVTLHGWLCRWTLMTLLD… |
| A0A178EUM6 | 252-518 | GFLHLNKLYVEKGRHETVWIILRAFQYTDNLSLQEEFLHPRFEVPSFSSAELSPAGYRFLVDLFLLCDKDNDGGLNEEELASIFAPT… |
| A0A5N6WGT1 | 120-388 | None |
| A0A5B8N2Q2 | 220-548 | None |
| A0A7J6ZSJ1 | 359-629 | None |
| A0A2U9CRL1 | 608-877 | None |
| A0A087H757 | 8-234 | None |
| A0A452RB94 | 213-477 | None |
| A0A4T0FPW9 | 212-513 | None |
| A0A183INQ2 | 2-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.