DPCstruct | MC4782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 390 |
|---|---|
| Mean domain length (aa) | 259 ± 56 aa |
| Standard deviation of domain lengths | 56.11 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.83 |
| Pfam Score | 84.13 |
| Assigned Pfam label(s) | CL0081- CL0010- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8FZ47 | 10-259 | LCAYFHLEGYELLSADYINAHTKLDIKCNKGHIYQATWNSFQRGRRCFICAHQHIGRCNANSHREFVNRLKDKTNGACVALSDYVNN… |
| A0A1C5X568 | 12-262 | LVAEWSEKNLPLTPDSITFGSNKKVWWKGACGHEWQTSVKARSNGEKCPICSGARVIAGINDLATLEPLLEKQWSKKNKIKPTEVSI… |
| A0A7S4RMT3 | 69-224 | None |
| A0A412J3G4 | 417-667 | None |
| A0A412J377 | 287-486 | None |
| A0A2N0QR13 | 154-364 | None |
| A0A6N7H122 | 4-161 | None |
| A0A7S4UH67 | 34-319 | None |
| A0A158BF73 | 231-485 | None |
| A0A0N1IKX8 | 236-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.