DPCstruct | MC47817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 213 ± 27 aa |
| Standard deviation of domain lengths | 27.25 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05786 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3T9U1 | 90-318 | VPRTQVGEHYGNCIRLAAENKITYKNAFDLHLIDYMGEMIKKEDFTSFRMASSSLDASAKIYAGRVDAVHQETYKVLTGLGRSDKPS… |
| A0A453EW83 | 5-149 | HKKKASTKRMLIGGYISLIRFFTTCTSLVLYLANAVSAMQISPASTLEPSFEALNVKKFDAAFTVDPLYHQTTAQFDEGGAKGLLLY… |
| B7XI04 | 4-207 | None |
| A0A540KGP5 | 1-169 | None |
| B0EKE7 | 1-190 | None |
| A0A067RKX7 | 56-305 | None |
| A0A0R3UGI6 | 111-296 | None |
| K2H1T6 | 1-219 | None |
| A0A3M0IR96 | 17-238 | None |
| A0A5J4NM68 | 3-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.