DPCstruct | MC47813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 155 |
|---|---|
| Mean domain length (aa) | 47 ± 5 aa |
| Standard deviation of domain lengths | 5.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 45.45 |
| Pfam Score | 97.81 |
| Assigned Pfam label(s) | CL0164- PF00057- CL0001- PF10393 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3T629 | 1-52 | INECERNNGGCQHRCINVEGSYSCDCNPGWQLGNDGRTCYSRFHCILVNSKR |
| A0A1X7SDU0 | 49-92 | DIDECSMGTSGCQQLCFNTNGSYYCQCNTGYKLMNDNSSCDDIN |
| A0A482WMH7 | 1-44 | None |
| A0A654H6K4 | 116-162 | None |
| A0A2C9JM73 | 15-53 | None |
| A0A553MYL4 | 10-73 | None |
| A0A7M5XBQ4 | 1-43 | None |
| H3B015 | 193-246 | None |
| H3B3G0 | 90-149 | None |
| A0A4W6CH41 | 234-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.