DPCstruct | MC47809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 219 ± 20 aa |
| Standard deviation of domain lengths | 19.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A382T9K3 | 14-224 | RDGKPCPIPVTIDPRVWRVLVAYSLEPPGHPGAETMQHLFWCWSGERENWMPSVRQVRSARMLREAIVGLGENSSVEPIMYSENTSA… |
| A0A7J4Q0M8 | 77-269 | TNVPEKPAAWALLLSLSLSPITSHAGETMFAIQHNWTSIAASPALVPAPLKRSIKFLSEIIEGNSERVFVQDKHLLVVGRLGHFYEV… |
| A0A7C7TXV0 | 316-520 | None |
| A0A075G4S4 | 102-318 | None |
| A0A2D8M6N7 | 272-475 | None |
| A0A2V4D1J3 | 48-244 | None |
| A0A7J4R2M5 | 4-242 | None |
| A0A7J4NGQ5 | 87-345 | None |
| A0A2D7VP61 | 276-501 | None |
| A0A2E6DTD4 | 9-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.