DPCstruct | MC47805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 278 ± 21 aa |
| Standard deviation of domain lengths | 21.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1QV24 | 1-297 | QVRLEELPWYERLAAAAKSHGLYDAEAAMGAARTAIAAVLAAWIGGFPGTITPNKLVSACRGLLDMAAFEYNAPLSILPECSANNFG… |
| A0A846YWM9 | 1-231 | MPNPMVGELSALAQQAGLRVPFVEELAADIFMGTFSVKFLRAARLAGDVLEGTLYERYYGVDYAAVRSMRWGFDKLCLKRAGKPAGW… |
| A0A0K6S7X9 | 3-267 | None |
| A0A1A7C973 | 47-338 | None |
| A0A239P5U2 | 351-610 | None |
| A0A1Q9U8V9 | 141-409 | None |
| A0A7W9LKW1 | 263-563 | None |
| A0A4Y6D002 | 472-766 | None |
| D9VSN6 | 84-375 | None |
| A0A2Z4V3C3 | 319-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.