DPCstruct | MC47801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 243 ± 70 aa |
| Standard deviation of domain lengths | 70.44 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800BQB4 | 35-278 | SKFSFFLLVLLVVIISLYEFYSMVFKEETRIAKWFGISVGLLPLIAIYSSNGLQSILGILVVCTIGLFTFFLFSNKPTISLINDLGK… |
| A0A537L9F5 | 16-209 | LTYVGGAAFAVFWTIVAALVLWEWARLTTSAGAAGPALAGWLAAGLGYAGVLLFAPLLLRRDPALGLTAMLFVFAIVWVTDIAAYFA… |
| A0A6G0XIS8 | 21-248 | None |
| A0A662X075 | 711-1090 | None |
| A0A7R9WC93 | 7-308 | None |
| A0A1T4LGW6 | 109-352 | None |
| A0A251XTY9 | 73-319 | None |
| A0A1I8FSB7 | 20-280 | None |
| L0AYP7 | 218-533 | None |
| A0A7Y3B4V4 | 536-786 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.