DPCstruct | MC478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 13.27 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318CVH7 | 76-183 | VEAGRNPNIEILTNAEVIAVEGRPGRFSVLVRRKPRYINEEACTGCGQCALYCLKVIGDDYNEHLSLTHAAHIDYAQAVPTSYHIDP… |
| A0A1W9QKG3 | 2-113 | ADVQDNENIRLLTNTEIVNTAGHRLHFEITARRKPRYIKDSIDMDICMGCEKCVQVCPVSVPNEWEQGIKSRKAIYIPAALAIPYKY… |
| A0A7C3QEC2 | 1-98 | None |
| A0A7C4M9P0 | 211-304 | None |
| A0A7C7V720 | 1-109 | None |
| A0A523UXR6 | 100-197 | None |
| A0A2G1NXD6 | 101-225 | None |
| A0A2M7JTT7 | 71-181 | None |
| A0A1V5WXZ2 | 93-194 | None |
| A0A0S8GFU8 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.