DPCstruct | MC47791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 133 ± 19 aa |
| Standard deviation of domain lengths | 19.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5ES55 | 1-116 | MDDSKKSVQKESLLQFLEHGVKYVFPQRPGPVVRGIPTAHSAPPLSEMVQSGDRVYVWPDIDGEARGESIVPLYPTVPKAARADKRF… |
| A0A5S9Q6H1 | 23-139 | DADVRPHIRNLSEFLEHGIQYVFVPERGALQRGMVTAYAASPLNSEFSGISEAPPVWPDPEGTVRGEAFSPLYKSAPAAARNDSKLY… |
| A0A5S9QLY1 | 32-171 | None |
| A0A0D9SHN2 | 91-211 | None |
| A0A2N2RM66 | 22-204 | None |
| A0A2M9TI63 | 111-249 | None |
| A0A3G3LFM9 | 19-158 | None |
| R9GQY5 | 75-189 | None |
| A0A512HKG7 | 50-188 | None |
| A0A1G7HHQ1 | 19-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.