DPCstruct | MC47788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 129 ± 16 aa |
| Standard deviation of domain lengths | 15.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A096W1H5 | 10-138 | FVLVAVFELGYAGLTPEKLKEIKPLIDTCIKESKVEEETLGKLHNGHEIPSSQSGKCFIACMAEHMKLMKDGKFEPAMTMEFIDKMV… |
| Q1W643 | 15-140 | LILQIALVYGEISDIDEFREMTSKYRKKCIGETKTTIEDVEATEYGEFPEDEKLKCYFNCVLEKFNVMDKKNGKIRYNLLKKVIPEA… |
| A0A3G2GRV5 | 2-134 | None |
| A0A1Y1NG30 | 23-154 | None |
| A0A834XTW4 | 5-117 | None |
| A0A182FAV3 | 21-151 | None |
| A0A7D5YRC8 | 7-152 | None |
| A0A7E5W4X8 | 4-135 | None |
| A0A7E5VQN3 | 2-131 | None |
| A0A2P8ZAA5 | 83-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.