DPCstruct | MC4778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 219 ± 28 aa |
| Standard deviation of domain lengths | 28.11 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A8JNT6 | 1-184 | MDAERAKETLERFRARNPEAVRLATHVSLATRIEAGLLRATRLRLSPPLDASHEADLWFSPLVESWSARAFVLHPAVARQLQAELWK… |
| A0A846HD55 | 3-239 | PTVAIRRIDSFEKRFGKPHLYLAYHAAFPLALTPQLLYSLWANFQQDIHGELLNIPWESVADLLLSSLCQEVGHELYEIDSAVRNEL… |
| A0A7Y4JM07 | 1-209 | None |
| A0A853ASU6 | 20-284 | None |
| A0A6N0ZD20 | 8-255 | None |
| A0A6H1LAI8 | 1-215 | None |
| A0A838RQM6 | 12-246 | None |
| A0A1Z4I144 | 13-234 | None |
| A0A6P1L151 | 3-194 | None |
| A0A6P0VX88 | 2-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.