DPCstruct | MC47777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 142 ± 11 aa |
| Standard deviation of domain lengths | 10.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 50.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3C5A1 | 24-170 | MNGMLGHLERQPKNKERCMAWLRFVEPLLKALGRFLLAHFRRIFPLFFQWTHSDDPETVLLVLERVETVLRLTWIGNSPRFNPKHYK… |
| A0A287XIX7 | 69-213 | MLGHLERQPLNKERRVAWLTLIGPVLDAMGLFLLAHFRLLFSLFFQWMHADDDRTVLLVLERIHTVVKLTWIRKSPYTSRLVDELVL… |
| A0A2R6RRA6 | 2-146 | None |
| A0A835UKX5 | 1-147 | None |
| A0A453SR98 | 1-147 | None |
| A0A7N0TPJ4 | 99-240 | None |
| W9RJ34 | 288-433 | None |
| A0A7S2QZ02 | 3-125 | None |
| A0A446YRW6 | 57-169 | None |
| D8SM01 | 256-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.