DPCstruct | MC47772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 342 ± 73 aa |
| Standard deviation of domain lengths | 72.58 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.50 |
| Pfam Score | 84.88 |
| Assigned Pfam label(s) | PF00425- PF04715- CL0261- CL0014- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G6ERH3 | 28-353 | KDIKEVKSLINQIEAYQEKGYFAVGYVAYEASQAFEPKFQIFDSPLMSEYLLYFTIHDTVQTESIPLAYEPVPLPESWQELTSAEEY… |
| A0A6D0EKB3 | 4-201 | SETHLPDKAAWLALVTNATEAIAHHDFDKVVLARATDLQFNRPVNPAALMAASRRVNLRCFHFFMQLDADNAFLGSTPERLWRRRGE… |
| A0A7S4UT62 | 437-851 | None |
| K8F3W6 | 468-907 | None |
| A0A7N2L3T2 | 42-301 | None |
| A0A7V2UKE9 | 2-250 | None |
| A0A318M3P8 | 92-391 | None |
| A0A6G3V3Q8 | 3-216 | None |
| C4JNZ5 | 256-627 | None |
| A0A7J6LF32 | 347-771 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.