DPCstruct | MC4777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 211 ± 51 aa |
| Standard deviation of domain lengths | 50.63 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.22 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0490- CL0320- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q9BGB9 | 8-187 | SRWLHIYLSMFSFIIVLFFSVTGLTLNHVDWFPESTVVSELKGSVNASWVSVADTAKIPKLDIVEQLRANHSIKGQLNDFRIDEEEI… |
| A0A846H4M9 | 62-270 | CILTITGLVLWPGWRKLIAGFKIKLDAHPQRANFDIHKVAGIITVVFLFFTGFTGFCWNFYDLTEPIIYAVTFTPKPSELVSKPIPG… |
| A0A2S6HFD1 | 8-193 | None |
| A0A2E9AU47 | 4-173 | None |
| A0A1B3X686 | 41-365 | None |
| A0A258R345 | 4-175 | None |
| A0A418VUK8 | 175-378 | None |
| A0A0H2MCI5 | 97-332 | None |
| A0A6G7BNX2 | 170-429 | None |
| A0A1C9VEY9 | 116-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.