DPCstruct | MC47764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 150 |
|---|---|
| Mean domain length (aa) | 89 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.88 |
| Pfam Score | 98.98 |
| Assigned Pfam label(s) | PF02594- PF11208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6NMG3 | 25-107 | VDWRVWRHAVKLLQIKVQPNARLSVLVEPGEDGTWAAELKAPPVDGKANDELLRLVAERFGVARSRVTLRTGASARLKRIRVD |
| A0A1H8UC30 | 1-78 | MRVRPGAGRTAVGGSHDGALVVRVSAPAVDGRATEAALAAVAEALGLRRRDVELVTGATSRTKVIAVPDGLEAAVAAL |
| A0A2D6LGI2 | 3-74 | None |
| A0A7C2IZM1 | 7-103 | None |
| A0A1V4Y8W5 | 53-148 | None |
| A0A6P6G6W7 | 100-192 | None |
| O28207 | 3-76 | None |
| A0A3P9H813 | 66-159 | None |
| A0A2H9TMV5 | 12-103 | None |
| A0A7S3PGW6 | 109-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.