DPCstruct | MC47756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 284 |
|---|---|
| Mean domain length (aa) | 97 ± 18 aa |
| Standard deviation of domain lengths | 18.35 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.53 |
| Pfam Score | 95.34 |
| Assigned Pfam label(s) | PF13340- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V0QCE3 | 4-93 | APMRAYDLTKEQWKRVKSLLPPPRADGRGRPRKNDRTMLNGMLWVVRNGAHWRMLPRKYGPWQSVYARFAKWRRDGTLVAVLLALSG… |
| A0A854VSE4 | 1-80 | MERMPYATDLSDGQWALIEPLVTAWKQERVARSATGDPGSCDLREVVNALLYQNRTGCQWRLLPHDLPAWSAVFYYFTLW |
| A0A2D2CX97 | 26-133 | None |
| A0A0Q4C1I7 | 19-116 | None |
| G7TC56 | 46-154 | None |
| A0A381EEE2 | 69-158 | None |
| A0A1S2Q6I2 | 4-107 | None |
| A0A381E972 | 3-91 | None |
| A0A1T3NJ41 | 145-247 | None |
| A0A4R7QHS0 | 31-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.