DPCstruct | MC47753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 250 ± 40 aa |
| Standard deviation of domain lengths | 39.73 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9EX76 | 39-266 | RQLQSRALGLIRSHVLSVLKRASSQVQAAIQSSGGNKASLSEGVEASVIYIRFKAAASELKPVLEEIESRASRKEYVHILAECHKLY… |
| A0A821C891 | 2-223 | KQVLLKALNIIKAHIIHILQNSSNTIDPNKNHTLLSDDAYTLFYGRFRINAPKVKVLAEELEQRCTRNPEYEKTLSDCHECYANQRR… |
| A0A453RTV3 | 104-411 | None |
| A0A183N7F0 | 1-213 | None |
| A0A5N5QM29 | 494-770 | None |
| A0A167CGJ2 | 295-568 | None |
| A0A0L0SQK6 | 31-346 | None |
| A0A7J0FWQ3 | 72-370 | None |
| A0A091DYH2 | 126-425 | None |
| A0A1S8X482 | 64-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.