DPCstruct | MC47749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 267 ± 17 aa |
| Standard deviation of domain lengths | 16.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6ZNH9 | 1-266 | MSTTSSHNEYKYALGSTLEDEESLAAGVPASKSFLSWRDVATIAVVLSAAAGAIIAVYLPATAVSLGQTNQLVIVGFCLTIMAMGTT… |
| A0A6A5ZWH3 | 1-240 | MNGPNLPNGDAAAAVPVAGSQIRRWNTANFIYFLLMAASTSFAVVVVVPDKWLSWKLGLQNQLIVVGIMLRIMTECLQVHFRHLLLL… |
| A0A5N6K8H4 | 1-258 | None |
| A0A397HRA5 | 1-263 | None |
| W9XN88 | 2-285 | None |
| A0A0D2DFG2 | 104-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.