DPCstruct | MC47747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6AKA2 | 1-108 | MARVDEIKVIEKLKKLILDQVQALYGPKYASACTFSVITSRFHSGGTLNEIEYNAQAIVYIHPGSHAEWKLLVEGDTGSSTQQAVEL… |
| A0A6A5ZML2 | 4-122 | LNDLEKVQLQLELKKLIISQAQAIYGPQLDTPCTYDVVISKAAGLYIARAIAYTEPNFRAYTVVRESSPKQSFSAAMRDLLDKLCEG… |
| A0A6A5TWK0 | 1-111 | None |
| A0A6A5QKB2 | 84-199 | None |
| A0A5N5DUZ9 | 8-135 | None |
| A0A7R7W618 | 9-107 | None |
| Q5B2Z3 | 1-126 | None |
| A0A6S6VRU1 | 24-127 | None |
| A0A6A5ZN69 | 2-121 | None |
| J3P7J9 | 10-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.