DPCstruct | MC4774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 8.16 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6TGC9 | 147-246 | TAKAKRERREAFESHLRAFRARFQDAEYPPEAEVEGETVYDTYSIYGTGSRIVIGDTWVWWVDNNGMDGDDWSRNNCRLGIARRLPR… |
| A0A077MBD9 | 6-99 | HRVRKMEARAIARTIETDGERPERAGYPDGDHFLGERTLYGGGQWVVVDADYIWSMHGNGADGDDWSANNVGGNIGWRIPRTDKMVA… |
| A0A842RM10 | 95-207 | None |
| A0A7C6H8S7 | 182-286 | None |
| A0A1G3M7G0 | 342-448 | None |
| A0A2J6WX59 | 170-281 | None |
| A0A259N713 | 242-344 | None |
| A0A843F3J8 | 17-138 | None |
| A0A2P1PZL4 | 326-427 | None |
| A0A246BTG8 | 143-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.