DPCstruct | MC47733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 243 ± 37 aa |
| Standard deviation of domain lengths | 36.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0JL35 | 7-259 | GYKCTTCPKEYKEKFNYDRHAACCAFLCKSRREQMNEIETGETIPTPLEMYRLIQELAIRNEKLEKELSKLKHVQNKKINILQWLNS… |
| A0A6C0EF11 | 24-282 | LKTEKIEKITYPRRCNRCTKIYKHKSSFSRHREKCKKSDDIVITKKMINELKKKFKKELKEELKNEICTEKKNINMSTLKLIEEKFK… |
| A0A6C0M1J2 | 114-387 | None |
| A0A6C0HXY2 | 6-235 | None |
| A0A6C0I162 | 141-404 | None |
| A0A6C0I751 | 2-254 | None |
| A0A6C0IC50 | 4-292 | None |
| A0A6C0ID94 | 12-227 | None |
| A0A6C0IGC2 | 1-220 | None |
| A0A6C0FD81 | 1-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.