DPCstruct | MC47730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 94 ± 15 aa |
| Standard deviation of domain lengths | 15.29 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.41 |
| Pfam Score | 92.59 |
| Assigned Pfam label(s) | PF02140- PF11875 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E9IPQ5 | 7-85 | LRQNTIIFAGYGYHEKTIDVTEKIKAGYKTGKREFKAGNDIAGDPFVGRRKSLYVVWTENGTTKSGAVEEGDGRGIVLP |
| A0A6C0JI93 | 4-86 | PPPGLEIVKATYGAEQYSEDVTKAVRDLIRDGSLSITVSPQAFGIIDPAPGVKKILQVNASLNGAAPTLFSAEDSKQLVINAP |
| A0A3N4KPN9 | 606-692 | None |
| A0A7S0M197 | 5-113 | None |
| A0A1G1A2G3 | 67-147 | None |
| A0A2V9TZG0 | 43-124 | None |
| A0A1A9XPR2 | 425-511 | None |
| A0A151HRL8 | 155-285 | None |
| A0A845U1T2 | 360-435 | None |
| A0A0J9VW86 | 343-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.