DPCstruct | MC4773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 11.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C1UCJ7 | 5-124 | SKHCFLCSQLLDKNNSTVEHIFPKWLQHKHELWNQKLCLSNNSHITYKRLIVPCCKKCNNKYLSKIEKKIREAFEGGIEKVRELDKT… |
| A0A6L9UIU1 | 21-125 | CFACGRTPTTGAGEHVIPKWLQSKLGLFDERLTLLNGTQIPYRSLTVPCCAECNNGFLSAIEREVHPIFTRGTLIAGDELVLGRWLS… |
| A0A482TW17 | 31-156 | None |
| A0A061M4G7 | 5-132 | None |
| A0A7V9AQG3 | 6-115 | None |
| A0A090VK89 | 10-157 | None |
| A0A3S9DUR3 | 53-170 | None |
| A0A385SW27 | 57-176 | None |
| A0A3G2G5P6 | 40-154 | None |
| A0A1C3XNV6 | 34-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.