DPCstruct | MC47726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 202 ± 26 aa |
| Standard deviation of domain lengths | 25.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5PPS6 | 28-197 | ASTNQLATFYSRLRACHVVICLQILVEHAGRWKTEEEPLPLLEAYTVAILSYAKATSCLSSECENVPLVLENLAMSCLELLLSLPEH… |
| A0A6P7EYC2 | 54-247 | SRDYCRRFCQVVEDYAGRWQVPLPQLQVLQTALCCFTSASASFPDECEHVQYVLSSLALSFFELLLFFGRDEFYEEPLKDILGSFQE… |
| F1R7Q9 | 1-179 | None |
| A0A7J8KFM2 | 49-272 | None |
| A0A151PG42 | 2-230 | None |
| A0A6P7TKK2 | 3-229 | None |
| A0A673HDW5 | 1-192 | None |
| A0A1S3SMP5 | 3-199 | None |
| D3ZJX1 | 42-240 | None |
| E7FBU0 | 9-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.