DPCstruct | MC47724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5PJ32 | 3-105 | WVFLGSNVSLLSFLQWKVRRTLAFSIHELALILGDQLTAADLVPIFNGFLKDLDEVRVGVLKHLYHFLKLLHQDTRRKYLYQLQEFL… |
| A0A2D4J820 | 34-136 | WHCLKDTYETLASDMQWKVRRTLAFSIHELAVILGDQLTAGDLVPVFNGFLKDLDEVRIGVLKHLHDFLKLLHPDKRREYLYQLQEF… |
| A0A833R9C4 | 382-484 | None |
| W2MAA5 | 338-455 | None |
| A0A6H5I5H2 | 369-463 | None |
| A9USW4 | 23-143 | None |
| A0A7I8XNA5 | 13-135 | None |
| A0A1X7T6J7 | 1-92 | None |
| A0A821HAP8 | 214-305 | None |
| Q171I6 | 5-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.