DPCstruct | MC47717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 164 ± 23 aa |
| Standard deviation of domain lengths | 23.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.70 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF02889- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B4RML8 | 101-229 | MNEWIEAINLVAATFSAPPLPAPVGSCKRFQRPALPFSCTQLPLMKQLEHHETKSKEAEGQLIESLQSKPQSGTGREFEEWQEKHEF… |
| A0A4W5NWL3 | 1-164 | MMSWIFRINLVAALFSAPAFPAAIGSMKTFCRPLLPSSSTRLNQEEQLQFHEGKLKQMSVEVEEHRKCPPSPSPKSREWEEYRIKEH… |
| B4DFU9 | 110-267 | None |
| G3N8V5 | 275-411 | None |
| A0A498M2D5 | 214-372 | None |
| A0A183EGA3 | 73-231 | None |
| C3Y058 | 149-355 | None |
| A0A1V4KR62 | 1075-1214 | None |
| A0A6P7V9I4 | 78-268 | None |
| B4R0N0 | 655-841 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.