DPCstruct | MC4771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C1U2K6 | 1-92 | MAMNSKGTFKEIGIREGEKLHEVIITKDDSRSTYEYENHYIIYPNFDWWNVSERFTEGGVLIEEGFEYNPSNNVKWLKVEELKELLN… |
| A0A377RZG7 | 13-96 | NTPTKIIGIRPGEKLHEVMIPKDESHLALEFEDFFIIQPTISFQTPKDYTLTKLHEKGHKVAPDFEYSSHNNSKWLEPDDLLKL |
| A0A1D3RPY7 | 139-232 | None |
| A0A821GIT0 | 136-227 | None |
| A0A7Y5KKW5 | 30-119 | None |
| A0A7X9JIM7 | 80-175 | None |
| Q1NW15 | 27-116 | None |
| K2B993 | 1-79 | None |
| A0A2E7TR73 | 37-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.