DPCstruct | MC47706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 138 ± 20 aa |
| Standard deviation of domain lengths | 20.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 35.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K5VZE8 | 7-153 | LARMDGSSEFTSHQGKSTIVVDIGGTTTDAGVLLPSGFPRQAAAFIEIGGVRTNFSMADVQSIGLGGGSRVKIHQTETGDAVTVGPD… |
| A0A7C1E0A6 | 78-211 | NAIVVDTGGTTSNIGALVNGYPREALEIELAGVRTNIRAPDIIAVGLAGGSIVKVSNGDIEVGPISVGYRLIEEGIAWGGNTLTATD… |
| A0A2U3K029 | 7-157 | None |
| A0A7G2M0S1 | 7-138 | None |
| A0A317WHJ4 | 277-409 | None |
| A0A6G3V8N1 | 96-213 | None |
| A0A6M0F5R8 | 147-265 | None |
| A0A7C7Y7V7 | 14-131 | None |
| H0EM88 | 238-372 | None |
| E7F6Z6 | 309-446 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.