DPCstruct | MC47705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 342 ± 39 aa |
| Standard deviation of domain lengths | 39.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K5VN79 | 33-366 | LGAISVWIKNSLIFRPGEQRWDKAIVPPAAYWDAEDEENLAEDDEVENLVAEGRMGPAIEERGLYFVSAVEYDYGIYSLPPARGLDA… |
| A0A137Q0F9 | 66-417 | FQMLRLMAMSKILSTQAGASPISHFIPEALTLTAACVWLINSLHSHHNDSSATRQLMQAALPLTEADGTDLDVLLYQTSTCSRRWNG… |
| A0A6A4GL36 | 504-874 | None |
| A0A5N5Q7I5 | 1-247 | None |
| A0A4Y9XQS2 | 74-376 | None |
| K5UIP9 | 178-538 | None |
| A0A0D2NWI1 | 33-368 | None |
| A0A2H3K6C5 | 4-382 | None |
| A0A0D0C0S8 | 116-525 | None |
| A0A2H3JPH7 | 8-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.