DPCstruct | MC47704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8QKV5 | 4-92 | QLDDAATIARVSLHDPEHFDIQRTQTLHRLALLKQWDIAPDSKILELGCGQGDCTAVLASAVGENGTVVAVDPASLDYGAPYTLGQA… |
| K5VIH2 | 1-85 | MASLSAEDIAALSLYDPKNWEVQLHQTEQRIALITQWDVQWQGAKVLEIGCGQGDCTAVLAEAVGPEGHVTAVDPAPLTYGELSP |
| Q2H823 | 4-95 | None |
| A0A146IN91 | 151-229 | None |
| A0A7G5J057 | 957-1044 | None |
| A0A317X6G8 | 8-83 | None |
| A0A094GP80 | 5-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.