DPCstruct | MC47703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 116 ± 5 aa |
| Standard deviation of domain lengths | 4.80 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q9NEC1 | 53-161 | MTQHPIRKSVSLQELTSPMGYHAKHIGPAICRFVVQFRHPTLSSYQLESRISETLIPFNHLPVYHRIKFWNEHIFGQETRDSIHVHP… |
| K5VGC7 | 1-112 | MQEPSAKAVSFYRLGAEYGAVNFEKCLSMYIVRLNNSQASPASVCDLVSTLCLGFQKVPVYHKVKFWESDFSQYRHASDEYNVIHVT… |
| A0A5M3M7H3 | 1-112 | None |
| A0A0C9WJ09 | 257-377 | None |
| A0A4S8KQK5 | 88-206 | None |
| A0A4Q9PXU4 | 602-714 | None |
| A0A4Y9ZKY6 | 67-179 | None |
| A0A0C9TV34 | 10-130 | None |
| A0A060SYC0 | 197-320 | None |
| A0A165N269 | 179-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.