DPCstruct | MC47702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 143 ± 5 aa |
| Standard deviation of domain lengths | 4.96 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 87.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02889 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K5V8A7 | 1-149 | MGIALPKTIVEGRNRLIVLAAYGLVFGGMLPALVGRWWFGNRDKTKDGVDARSAAVFFKSLNEDSGLDEVVASLGKSFEYEQPQKKS… |
| A0A6A0H3Q1 | 142-287 | FGIALPSWIVEKENSLVVLGLYALVFMFGMPTVVAIWWYRSSKFSADQVLLDTTQLYYYFFHKTPSMPYKRALMVLSASFEFEKGHN… |
| A0A177WEP3 | 75-222 | None |
| A0A7S3AVS0 | 4-140 | None |
| A0A5K3FZM8 | 1-143 | None |
| T1K9J7 | 91-236 | None |
| M7C0Y7 | 414-558 | None |
| A0A2A2K2C1 | 3-131 | None |
| A0A0N4W755 | 156-300 | None |
| K7FE57 | 35-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.