DPCstruct | MC477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 98 ± 13 aa |
| Standard deviation of domain lengths | 12.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12986 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844FJP3 | 1-74 | MNTKTGIIEDVMVTLLSDLCKEFLSHLMVGHNIKEDGIDEIVDKVENRFFGYSQKAVVVAMKGAYRRYVEWERT |
| A0A3N0EFG0 | 17-119 | VLVSGYARLPDAVASHSQYERLGVILAVDMSDGSIVAADTTLLTDLARDFFRALVEGASVAEDASGLVRRVQRRYAGHSGGALTTAL… |
| G9QIK6 | 82-181 | None |
| H5UU61 | 46-144 | None |
| A7VJM7 | 2-74 | None |
| A0A7X7U6W7 | 2-104 | None |
| A0A7C6ZGQ8 | 21-133 | None |
| A0A2G5VWR8 | 1-85 | None |
| A0A357B332 | 8-109 | None |
| A0A1I3SZ60 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.