DPCstruct | MC47697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 189 ± 14 aa |
| Standard deviation of domain lengths | 13.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 69.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2XEF1 | 13-180 | GKVRTVADFLHENVLDFIDNDAIDDAWSVASYLSEADCLLAGSPISSTRWMVNESYEAENMTQLIAASVAARGILFGNAHVSSSRWH… |
| A0A6A4SL71 | 198-396 | LVDPELVVERSHMSGGFFNLYLHQNYLDFFSEVEDVARASEYLSDSDLLTADWTSRSTMEDYGSSVATRGLLHSNSQQVSVGFRPLH… |
| A0A6P3ZGR3 | 90-261 | None |
| A0A6P5FDJ5 | 325-522 | None |
| A0A7S1B4E5 | 27-220 | None |
| A0A817E6R3 | 150-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.