DPCstruct | MC47694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 10.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0360 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C1RTZ8 | 2-101 | LFEIQIVPVGADPHISNAIADSVSIIDSAGLRYQLTASGTLIEGDWDEVIPVLKRAHEQARRYAPHLITTIRVEDDPEATEQLTENV… |
| A0A5N7CE14 | 14-89 | HCLADFCLIPIGTSSPSVSAQIADVQRLIEKSGLKYVMHSAGTTLEGPWDKVHQVIGQAHTLLHQQGVVRIQTDNR |
| A0A066YP92 | 2-76 | None |
| A0A6A0AYH2 | 53-143 | None |
| A0A2V2E5D6 | 2-97 | None |
| A0A4U0VLT4 | 2-115 | None |
| A0A3N4IEF3 | 69-183 | None |
| H1LGU9 | 84-175 | None |
| Q2H9X5 | 3-107 | None |
| A0A7K2AIJ3 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.